KEGG   Escherichia albertii: EAKF1_ch1709c
Entry
EAKF1_ch1709c     CDS       T03986                                 

Name
(GenBank) putative chaperone
  KO
K12787  LEE-encoded effector Map
Organism
eal  Escherichia albertii
Pathway
eal05130  Pathogenic Escherichia coli infection
Module
eal_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:eal00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    EAKF1_ch1709c
SSDB
Motif
Pfam: IpaB_EvcA FlgT_N
Other DBs
NCBI-ProteinID: AHE59593
UniProt: W0AQ39
LinkDB
Position
complement(1810061..1810561)
AA seq 166 aa
MRFVPVQSNLVINHGKLTNQLLQAVAKQTRSGDTQQWFQQEQTTYISRTVNRTLDDYCRS
NNSVISKETKGHIFRAVENALQQPLDMNGAQSSICQFLQSNKYFNQKVDERCGKGVDPIT
RFNTQTKMIEQVSQEIFERNFNGLKVSDIKAITQNAIADHVQDTRL
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaggttcgtgcccgtgcagtcgaaccttgtgattaatcatggcaaactgactaaccaa
ctcctgcaggctgtagccaaacaaactcgtagtggagatacccaacaatggttccagcag
gagcagacgacttatatatccagaacagtaaacagaactctggatgactattgcaggagt
aataattcggtcattagtaaggagactaaaggtcacatttttagagctgttgaaaatgcg
ttacagcaacctcttgatatgaatggggcacaatcatcaatttgtcagttcttgcagtcc
aataaatactttaatcagaaagttgatgagcggtgcggcaaaggggtggatccaataaca
cgttttaacacccagaccaagatgatagaacaagtctcacaagaaatatttgaacgcaac
tttaatggcttaaaagtcagtgatataaaagcgattactcagaatgcgattgcagatcat
gtacaggatacccggttgtag

DBGET integrated database retrieval system