Erwinia amylovora CFBP1430: EAMY_1475 Help Entry EAMY_1475         CDS       T01197                                  Symbol acpP Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism eam  Erwinia amylovora CFBP1430 Pathway eam00998   Biosynthesis of various antibiotics eam01100   Metabolic pathways eam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EAMY_1475 (acpP)    00074 Mycolic acid biosynthesis     EAMY_1475 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EAMY_1475 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH TerB Motif Other DBs NCBI-ProteinID:  CBA20425 UniProt:  D4I100 LinkDB All DBs Position 1545131..1545367 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNTASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattggcgagcagctgggcgttaagcag gaagaagttgttaatactgcctcttttgtggaagatctgggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgataccgagattccagacgaagaagct gagaaaatcactaccgttcaggctgctattgattacatcaatggtcaccaggcgtaa

DBGET integrated database retrieval system