Erwinia amylovora CFBP1430: EAMY_1595 Help Entry EAMY_1595         CDS       T01197                                  Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism eam  Erwinia amylovora CFBP1430 Pathway eam00998   Biosynthesis of various antibiotics eam01100   Metabolic pathways eam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EAMY_1595    00074 Mycolic acid biosynthesis     EAMY_1595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EAMY_1595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CBA20545 UniProt:  D4I1Q4 LinkDB All DBs Position 1657355..1657594 Genome browser AA seq 79 aa AA seqDB search MKNVSSFSTVTHLIQQINGSLPQHVTLQHSLIKDLKMDSVELIDLFLRLEQAGIIMDESQ ISSQLTVGDIVKLIEGTDA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gtgaagaatgttagttcgttttctacggtaactcatttgattcaacagattaatggtagc ttgccacagcatgttactcttcagcatagtctgattaaagatctgaagatggattctgtg gagcttatcgatctgtttttacgacttgaacaggctggaataattatggatgagtcacag atcagcagtcaactcaccgtaggagatattgtaaaattaatagaaggtactgacgcatag

DBGET integrated database retrieval system