Ewingella americana: GXP68_07595 Help Entry GXP68_07595       CDS       T06747                                  Symbol dinI Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism eame  Ewingella americana Brite KEGG Orthology (KO) [BR:eame00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:eame03400]     GXP68_07595 (dinI) DNA repair and recombination proteins [BR:eame03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     GXP68_07595 (dinI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI KH_SLS1_1 Motif Other DBs NCBI-ProteinID:  QMV51236 LinkDB All DBs Position complement(1647594..1647842) Genome browser AA seq 82 aa AA seqDB search MRVEVTIDKTKPLPAGALEALSGEFSKRINQQFSDTDNKVQVRYAGSNNLSVMGAPKTDR DRIEEILQETWESADEWFSTDD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaagtcacaatcgataaaaccaaacctcttccagccggtgctcttgaagcg ctgtcaggtgaattcagtaaaagaataaaccaacaattttccgatacggataacaaagtt caggttcgctatgctggctccaataacctgtcggttatgggcgcgccaaagacggaccgc gatcgtattgaagaaattctgcaagaaacctgggaaagcgccgatgagtggttttctacg gatgattaa

DBGET integrated database retrieval system