Ewingella americana: GXP68_07655 Help Entry GXP68_07655       CDS       T06747                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eame  Ewingella americana Pathway eame01100   Metabolic pathways eame01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eame00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GXP68_07655 (acpP)    00074 Mycolic acid biosynthesis     GXP68_07655 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GXP68_07655 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  QMV51246 LinkDB All DBs Position 1659828..1660064 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVVNAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacagctgggtgttaaacag gaagaagtagttaatgctgcgtctttcgtagacgaccttggcgctgattctctcgacacc gttgagctggttatggctctggaagaagagtttgataccgagatccctgacgaagaagct gaaaagatcactactgttcaggcagctattgattttatcaacgctagccagcagtaa

DBGET integrated database retrieval system