Ewingella americana: GXP68_11560 Help Entry GXP68_11560       CDS       T06747                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eame  Ewingella americana Pathway eame01100   Metabolic pathways eame01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eame00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GXP68_11560    00074 Mycolic acid biosynthesis     GXP68_11560   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GXP68_11560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QMV51918 LinkDB All DBs Position complement(2508530..2508778) Genome browser AA seq 82 aa AA seqDB search MIDYNEVYSKVCAMLCEAKDLEMESLSPDMPLSQLKLDSLDYVELMLLANKEFSVTIETD VFADQPDLTLRELCEFISEKGE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgattgattacaatgaagtttatagcaaagtttgcgccatgctgtgtgaagcaaaagat ctcgaaatggagtccctttctccagacatgcccctttcacagctcaagttagacagtttg gattatgttgaactgatgcttctggccaacaaagagttcagcgttacgatagaaacggac gttttcgctgaccaacctgatctcactctacgtgagctttgcgaattcattagtgagaag ggtgaatag

DBGET integrated database retrieval system