Klebsiella aerogenes EA1509E: CCG32879 Help Entry CCG32879          CDS       T02447                                  Name (GenBank) Acyl carrier protein (ACP1)   KO K02078   acyl carrier protein Organism ear  Klebsiella aerogenes EA1509E Pathway ear01100   Metabolic pathways ear01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ear00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCG32879    00074 Mycolic acid biosynthesis     CCG32879   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCG32879 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CCG32879 LinkDB All DBs Position complement(4253539..4253796) Genome browser AA seq 85 aa AA seqDB search MEALYLEIKNLIISTLNLDELSADDIDTDAALFGDGLGLDSIDALELGLAVKKQYGVVLS AESEEMRQHFFSVATLASFIQAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaagcgctctatcttgaaattaaaaatctgattatcagtacattgaacctggacgag ttgtccgctgatgatatcgacaccgatgccgcgctgtttggcgatggtctgggtctggac tccatcgatgcgctggagctgggtctggcggtgaaaaaacagtacggcgtggtgctgtcg gcagaaagcgaagagatgcgccagcacttcttttccgtcgccacgctggcatcctttatt caagcgcagcgtgcctga

DBGET integrated database retrieval system