Enoplosus armatus (old wife): 139298679 Help Entry 139298679         CDS       T11455                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism earm  Enoplosus armatus (old wife) Pathway earm04382   Cornified envelope formation earm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:earm00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     139298679 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     139298679 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:earm04147]     139298679 (s100a10a) Exosome [BR:earm04147]  Exosomal proteins   Exosomal proteins of microglial cells    139298679 (s100a10a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_FSTL1 EF-hand_8 EH SPARC_Ca_bdg EF-hand_STIM1 EF-hand_SWAP70_N Motif Other DBs NCBI-GeneID:  139298679 NCBI-ProteinID:  XP_070777487 LinkDB All DBs Position 16:14426880..14428675 Genome browser AA seq 100 aa AA seqDB search MPSELEGAMESLIKVFHRYASKDGRSGTLSRRELRELMENELSTFLKSQKDPAAVDKIMK DLDTNGDGQVDFEEFVSLVVGLSIACEQCYQMHMKKMGKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttctgagctggagggagccatggagtcactcatcaaggtgttccaccgttacgcc tccaaggacggccggagcggcacactcagccggcgagagctcagagagttgatggagaac gagctgtctaccttccttaagtctcagaaggaccctgctgctgtagacaaaatcatgaag gatctggacaccaacggtgacggccaggtggactttgaggagtttgtttctctggttgtt ggactttccatcgcctgtgagcagtgctatcagatgcacatgaagaagatgggaaagaag taa

DBGET integrated database retrieval system