Enoplosus armatus (old wife): 139300991 Help Entry 139300991         CDS       T11455                                  Name (RefSeq) dynein axonemal light chain 4   KO K10412   dynein axonemal light chain 4 Organism earm  Enoplosus armatus (old wife) Pathway earm04814   Motor proteins Brite KEGG Orthology (KO) [BR:earm00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     139300991  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:earm03037]     139300991    04812 Cytoskeleton proteins [BR:earm04812]     139300991 Cilium and associated proteins [BR:earm03037]  Motile cilia and associated proteins   Dynein arm    139300991 Cytoskeleton proteins [BR:earm04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      139300991 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  139300991 NCBI-ProteinID:  XP_070780320 LinkDB All DBs Position 2:24439982..24442537 Genome browser AA seq 106 aa AA seqDB search MAGTGEGKKEEADYKRLHSFPLIRHTDMPEEMRVETMELCVTACEKFATNNESAAKMIKE SMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctgggactggcgagggaaagaaggaagaggccgactacaagagactgcacagcttc cctctcatcaggcacacagacatgccagaagaaatgagggttgagaccatggagctctgt gttacagcctgtgaaaagtttgccaccaacaacgagagtgcagcgaagatgatcaaagag tctatggacaagaaattcggcagctcgtggcacgtggtgatcggcgaaggcttcggcttt gaggtcacacacgaagtgaagaacctgctctacatgttcttcggagggagcctggccgtg tgtgtgtggaagtgctcgtag

DBGET integrated database retrieval system