Enoplosus armatus (old wife): 139303319 Help Entry 139303319         CDS       T11455                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism earm  Enoplosus armatus (old wife) Pathway earm04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:earm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     139303319  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:earm04121]     139303319    03400 DNA repair and recombination proteins [BR:earm03400]     139303319 Ubiquitin system [BR:earm04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      139303319    Cul5 complex      139303319 DNA repair and recombination proteins [BR:earm03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      139303319 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  139303319 NCBI-ProteinID:  XP_070783192 LinkDB All DBs Position 20:10633655..10637144 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRTPEDQRLYKDDQLLEDSKTLGDC GFTNQTARPQAPATVGLAFRINDEMFEQLHVEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacaatcttcacagatgccaaggag tccaccacagtctatgagctgaagcgcattgttgaaggaattcttaaaagaacacctgaa gaccagaggctctacaaagatgatcagttgctagaggacagcaaaactcttggtgactgt ggattcaccaaccagactgccagacctcaagccccagctacagttggtctggccttccgc ataaatgatgagatgttcgaacagctgcacgtcgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactctggtagcactgccaacgaacaggctgtgcagtga

DBGET integrated database retrieval system