Enterobacter soli: Entas_1213 Help Entry Entas_1213        CDS       T01604                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism eas  Enterobacter soli Pathway eas00190   Oxidative phosphorylation eas01100   Metabolic pathways eas02020   Two-component system Module eas_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:eas00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Entas_1213  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Entas_1213 Enzymes [BR:eas01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Entas_1213 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AEN63959 LinkDB All DBs Position 1327001..1327114 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALALEHIEASKASDEKH NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattttggggacgcttcttgcctgtgcatttggcatcattact gccctggcgcttgagcacattgaagcgtccaaagcgagtgacgaaaaacactaa

DBGET integrated database retrieval system