Enterobacter soli: Entas_1627 Help Entry Entas_1627        CDS       T01604                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism eas  Enterobacter soli Pathway eas01100   Metabolic pathways eas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Entas_1627    00074 Mycolic acid biosynthesis     Entas_1627   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Entas_1627 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AEN64368 LinkDB All DBs Position 1766545..1766781 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system