Exiguobacterium aurantiacum: NMQ00_09640 Help Entry NMQ00_09640       CDS       T08404                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eaur  Exiguobacterium aurantiacum Pathway eaur00998   Biosynthesis of various antibiotics eaur01100   Metabolic pathways eaur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eaur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NMQ00_09640 (acpP)    00074 Mycolic acid biosynthesis     NMQ00_09640 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NMQ00_09640 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Fas_alpha_ACP Guanylate_cyc Ribosomal_L12_N DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UTT41824 LinkDB All DBs Position complement(1858176..1858415) Genome browser AA seq 79 aa AA seqDB search MTTEQILVDVQAAVAEKLGKDVSEITADKSFKDDLGADSLEVMEMVMDLEDKFDITIEDE DAEKLATVGDVVAYIETKL NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgacaacagaacaaatcttagtagacgtacaagcagcagtggcagagaaactcgggaaa gatgtatctgagatcacagccgacaaatcattcaaagacgacctcggcgcggattcgctc gaagtgatggaaatggtcatggaccttgaagacaagttcgatatcacaatcgaagacgaa gatgcagagaaactcgcgactgttggcgacgtcgtcgcttacatcgaaactaaattgtaa

DBGET integrated database retrieval system