Enterobacter adelaidei: AAHF05_08625 Help Entry AAHF05_08625      CDS       T10740                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eax  Enterobacter adelaidei Pathway eax01100   Metabolic pathways eax01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eax00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AAHF05_08625 (acpP)    00074 Mycolic acid biosynthesis     AAHF05_08625 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AAHF05_08625 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  XGV93065 LinkDB All DBs Position 1764816..1765052 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system