Erwinia amylovora ATCC 49946: EAM_1459 Help Entry EAM_1459          CDS       T01199                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eay  Erwinia amylovora ATCC 49946 Pathway eay00998   Biosynthesis of various antibiotics eay01100   Metabolic pathways eay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EAM_1459 (acpP)    00074 Mycolic acid biosynthesis     EAM_1459 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EAM_1459 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH TerB Motif Other DBs NCBI-ProteinID:  CBJ46134 LinkDB All DBs Position 1582658..1582894 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNTASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattggcgagcagctgggcgttaagcag gaagaagttgttaatactgcctcttttgtggaagatctgggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgataccgagattccagacgaagaagct gagaaaatcactaccgttcaggctgctattgattacatcaatggtcaccaggcgtaa

DBGET integrated database retrieval system