KEGG   Aromatoleum aromaticum: ebA5815
Entry
ebA5815           CDS       T00222                                 
Symbol
recJ
Name
(GenBank) Exodeoxyribonuclease VII, single-stranded DNA-specific exonuclease
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
eba  Aromatoleum aromaticum
Pathway
eba03410  Base excision repair
eba03430  Mismatch repair
eba03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:eba00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    ebA5815 (recJ)
   03430 Mismatch repair
    ebA5815 (recJ)
   03440 Homologous recombination
    ebA5815 (recJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eba03400]
    ebA5815 (recJ)
DNA repair and recombination proteins [BR:eba03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     ebA5815 (recJ)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ebA5815 (recJ)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ebA5815 (recJ)
SSDB
Motif
Pfam: DHH RecJ_OB DHHA1 Glyco_transf_4
Other DBs
NCBI-ProteinID: CAI09425
UniProt: Q5NZT9
LinkDB
Position
complement(3452922..3454613)
AA seq 563 aa
MTRIQSRTVPPRVVQRLIDGGTHPLLARIYAARGISRREELDYGLKGLLPPGALRGTDEA
AQLLADAIEAGARMVIVADYDCDGATACAVGVRALRAFGADVGYLVPNRFEYGYGLTPAI
VELAARMEPDLLITVDNGIASVEGIAAARSYGMATLITDHHLPGDALPDADVIVNPNQPG
CDFPSKALAGVGVMFYTMLALRAELRSRGAFSGRQEPNLGELLDLVALGTVADVVKLDHN
NRILVAQGLARMRAGRMQPGVRALFAAAGREFERANTFDLGFALGPRLNAAGRLSDMSLG
IECLISDDMGRALNIAQDLDKLNRERRSIEQGMQEDALMRLAGFDPGQTASVSLFEPDWH
QGVIGIVAGRIKEKLHRPVVAFARGADGELKGSGRSIANVHLRDALDLVAKRHPDLILRF
GGHAMAAGLTIRETDYRRFGGAFEEIVQSLVGTADLTRTLETDGVLESGYMTLDSARLIE
QDIWGQGFAAPVFEDHFRVDNQRLLKDKHLKLQLSKNGVRFDAIRFNFAESAGASIHAAY
RLAPNEYNGVTNLQLMLEHFDTV
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgacacgcatccagtcccgcaccgttccgccccgcgtcgtccagcgcctgatcgacggc
ggcacccatccgctgctcgcgcgcatttatgcggcgcgcggcatctcgcggcgcgaggag
ctcgactacggcctcaaggggctgctgccgccgggggcgctgcgcggcaccgatgaagcc
gcgcaactgctcgccgacgcgatcgaggccggcgcgcggatggtgatcgtcgccgactac
gactgcgacggcgccactgcctgcgccgtcggagttcgggccttgcgcgctttcggcgcc
gacgtcggctatctcgtgccgaaccgcttcgaatacggctacggcctcacgccggcgatc
gtcgaactggctgcgcggatggagcccgacctgctgatcaccgtcgacaacggcatcgcc
agtgtcgaagggatcgccgcggcgcgcagctacggcatggcgacgctcatcaccgaccat
cacctgcccggcgacgcgctccccgatgcggacgtcatcgtcaatccgaatcagccgggc
tgcgacttcccgagcaaggcgctcgccggcgtcggcgtgatgttctacacgatgctcgcg
ctgcgcgccgaactgcgcagccgcggcgcgttctccgggcggcaggaaccgaacctcggc
gagctgctcgacctcgtcgcgctcggcactgttgccgacgtcgtgaagctcgaccacaac
aaccgcatcctcgtcgcccaggggctcgcccgcatgcgagccgggcgcatgcagcccggc
gtccgcgcgctgttcgccgcggccggacgcgagttcgaacgcgcgaacactttcgacctc
ggtttcgcgctcggcccgcggctgaacgccgccggtcggctctcggacatgagcctgggc
attgaatgcctgatcagcgacgacatgggccgcgcgctgaacatcgcccaggatctcgac
aagttgaaccgcgagcggcgcagcatcgaacagggcatgcaggaagacgcgctgatgcgc
ctcgctggcttcgacccgggacaaacggcgtccgtgagcctgttcgagccggactggcac
cagggcgtcatcggcatcgtcgccggacgcatcaaggagaaactgcaccggcctgtcgtc
gcattcgcgcgcggcgcggacggcgaactgaagggatcggggcgctcgattgccaacgtg
cacctgcgcgacgcgctcgatctcgtcgccaagcggcatcccgacctgatcctgcgcttc
ggcggccacgcgatggcggcgggcctgacgatccgcgaaacggattaccggcgcttcggg
ggggcgttcgaggagatcgtccaatcactcgtcggcaccgccgacctgacgcgcacgctg
gaaaccgacggcgtgctcgaaagcggttacatgacgctcgattcagcgcgactgatcgaa
caggacatctggggacagggcttcgcggcgccggtgttcgaggaccatttccgcgtcgac
aaccagcgtctgctcaaggacaagcacctgaagctgcagttatcgaagaacggcgtgcgc
ttcgacgcgatccgcttcaacttcgccgagagcgcgggagcgagcatccatgctgcctac
cggctcgcgccgaacgaatacaacggcgtcaccaacctgcagttgatgctcgaacacttc
gacactgtatag

DBGET integrated database retrieval system