Aromatoleum aromaticum: ebA6183
Help
Entry
ebA6183 CDS
T00222
Name
(GenBank) conserved hypothetical protein
Organism
eba
Aromatoleum aromaticum
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
YaeQ
Motif
Other DBs
NCBI-ProteinID:
CAI09658
UniProt:
Q5NZ56
LinkDB
All DBs
Position
3664650..3665189
Genome browser
AA seq
179 aa
AA seq
DB search
MALKATIFKVELTIADMDRNYYADHSFTIARHPSETGERMMVRILAFALYADPALAFGKG
LCVDDEPDLWQRDLTGAIERWIDVGQPDEKWIRKACGRARETVVVSYGRAADIWWNGVRD
KLARQSNLTVWNLPPDVAPALAALTARSMRLQCTLQDGQVWITDGRQTVLVEPARRMGA
NT seq
540 nt
NT seq
+upstream
nt +downstream
nt
atggcgctgaaggcaacgattttcaaagtcgaattgacgattgcggacatggaccgcaat
tactacgccgatcacagtttcacgatcgcccgccacccgtcggaaaccggcgagcgaatg
atggtgcgcatcctcgcgttcgcgctgtatgccgatccggcgctcgcgttcggcaagggc
ttgtgcgtcgatgacgagccggatctgtggcagcgggatctgaccggcgcgatcgagcgc
tggatcgacgtcggccagcccgacgaaaagtggatccggaaagcctgcggacgggcgcgc
gaaacggtcgtcgtcagctacggccgggcggcggacatctggtggaacggcgtgcgcgac
aagctcgcgcggcagtcgaacctgacggtatggaacctcccccccgacgtggcgcccgcg
ctcgccgcgctgaccgcgcgcagcatgcggctgcaatgcacgctgcaggacggccaggta
tggatcaccgacggccggcagacggtactcgtcgagccggcgcgcaggatgggcgcgtga
DBGET
integrated database retrieval system