Aromatoleum aromaticum: ebD125 Help Entry ebD125            CDS       T00222                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism eba  Aromatoleum aromaticum Pathway eba01100   Metabolic pathways eba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eba00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ebD125 (acpP)    00074 Mycolic acid biosynthesis     ebD125 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ebD125 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAI10128 UniProt:  Q5NXT6 LinkDB All DBs Position 4169522..4169818 Genome browser AA seq 98 aa AA seqDB search MTEIAPALPAPDNLDALRLEVAGIIVEALNLEQAPASIPPDDSLFGEGLGLDSIDILEVA LVVSKRYGFQLRADDDDNIRIFRSLRSLTGYIASHRTQ NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacagaaatcgctcctgccctgcccgctccggacaacctcgacgcgctccggctcgag gtcgccgggatcattgtcgaagcgctcaacctcgagcaggcgccggcttcgatccctccc gacgactccctgttcggcgaaggcctcgggctcgattcgatcgacatcctcgaagtggcc ctcgtggtgtcgaaacgctacggcttccagctgcgcgccgatgacgacgacaacatcagg atcttccgttcgctgcgcagcctgaccggatacatcgccagccaccgcacgcaatga

DBGET integrated database retrieval system