Enterobacteriaceae bacterium bta3-1: F652_3264 Help Entry F652_3264         CDS       T09572                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism ebb  Enterobacteriaceae bacterium bta3-1 Pathway ebb02020   Two-component system ebb02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ebb00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     F652_3264  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     F652_3264  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ebb02035]     F652_3264 Bacterial motility proteins [BR:ebb02035]  Flagellar system   Flagellar assembly proteins    Others     F652_3264 SSDB OrthologParalogGFIT Motif Pfam:  FlgM K1 Motif Other DBs NCBI-ProteinID:  AJR01253 LinkDB All DBs Position 3642178..3642450 Genome browser AA seq 90 aa AA seqDB search MKVTPSQYNLTQAVNSAANTQSVSAESTTPLRTQATAPVDPVLGEAQAQLAAMPEVDMAR VTAMKDAISAGKIDINLDELTLAIEKYYKG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaagtaaccccaagccagtacaacctgactcaggccgtaaacagcgccgcaaatacc caaagtgtcagtgcggaatctacgaccccgctacgtactcaggctactgctccggttgat ccggtattgggtgaagcgcaagcacagcttgctgcgatgccggaagtggatatggcacgc gtaaccgcgatgaaagacgccatcagcgccggaaaaattgacatcaatctggacgaactc acgctcgccatagagaaatattacaaagggtaa

DBGET integrated database retrieval system