Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_2507 Help Entry ECBD_2507         CDS       T00939                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ebd  Escherichia coli BL21-Gold(DE3)pLysS AG Pathway ebd01100   Metabolic pathways ebd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECBD_2507    00074 Mycolic acid biosynthesis     ECBD_2507   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECBD_2507 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ACT29529 UniProt:  A0A140NCR5 LinkDB All DBs Position complement(2627967..2628203) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system