Escherichia coli BL21(DE3): B21_00683 Help Entry B21_00683         CDS       T02096                                  Symbol ybgT Name (GenBank) small membrane protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ebe  Escherichia coli BL21(DE3) Pathway ebe00190   Oxidative phosphorylation ebe01100   Metabolic pathways ebe02020   Two-component system Module ebe_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ebe00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     B21_00683 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     B21_00683 (ybgT) Enzymes [BR:ebe01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      B21_00683 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  CAQ31200 LinkDB All DBs Position 732851..732964 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgaacacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system