Escherichia coli BL21(DE3): B21_01098 Help Entry B21_01098         CDS       T02096                                  Symbol acpP Name (GenBank) apo-[acyl carrier protein]   KO K02078   acyl carrier protein Organism ebe  Escherichia coli BL21(DE3) Pathway ebe01100   Metabolic pathways ebe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B21_01098 (acpP)    00074 Mycolic acid biosynthesis     B21_01098 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B21_01098 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  CAQ31615 UniProt:  A0A140NCR5 LinkDB All DBs Position 1154176..1154412 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system