Enterobacteriaceae bacterium FGI 57: D782_0851 Help Entry D782_0851         CDS       T02431                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ebf  Enterobacteriaceae bacterium FGI 57 Pathway ebf01100   Metabolic pathways ebf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D782_0851    00074 Mycolic acid biosynthesis     D782_0851   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D782_0851 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GshA Motif Other DBs NCBI-ProteinID:  AGB76896 UniProt:  L0M2E6 LinkDB All DBs Position complement(865490..865741) Genome browser AA seq 83 aa AA seqDB search MTDQTAVYQEVTSLLVKLFEVDPAAITPEARLYEDLELDSIDAVDMIVQLQKKTGKKIKP EEFKAVRTVQDVVDAVERLLREA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccgaccaaactgctgtctatcaggaagtcacttccctgctggtaaaactgttcgaa gtagacccggcggccatcacccccgaggcgcgcctgtatgaagatcttgaactcgatagc attgatgctgtggatatgatcgtccagttgcagaaaaagaccggcaagaaaattaagccg gaagagttcaaagccgtgcgcaccgtgcaggatgtggttgacgccgtcgagcgcctgctg cgggaagcctga

DBGET integrated database retrieval system