Enterobacteriaceae bacterium FGI 57: D782_0852 Help Entry D782_0852         CDS       T02431                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ebf  Enterobacteriaceae bacterium FGI 57 Pathway ebf01100   Metabolic pathways ebf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D782_0852    00074 Mycolic acid biosynthesis     D782_0852   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D782_0852 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGB76897 UniProt:  L0M0P8 LinkDB All DBs Position complement(865754..866011) Genome browser AA seq 85 aa AA seqDB search MQELYSEIKHLIINTLNLDELSVDDIDTDAALFGDGLGLDSIDALELGLAVKNQYGIVLS AENEAMRQHFYSVATLAAFIQSQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagagctctattctgagattaaacatctcatcattaacacattgaatctggacgaa ctgagcgtggacgacatcgataccgatgcggccctgttcggtgacggtttaggcctggat tctattgatgcgctggagctggggctggcggtaaaaaaccagtatggcattgtgctttct gctgaaaatgaagcgatgcgtcagcatttctattcggtggcgacgctcgctgccttcatt caatcccaacgcgcctga

DBGET integrated database retrieval system