KEGG   Enterobacteriaceae bacterium FGI 57: D782_2897
Entry
D782_2897         CDS       T02431                                 
Name
(GenBank) lipid A export permease/ATP-binding protein MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    D782_2897
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebf02000]
    D782_2897
Enzymes [BR:ebf01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     D782_2897
Transporters [BR:ebf02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    D782_2897
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N DEAD Zeta_toxin AAA_16 DUF87 APS_kinase AAA_22 nSTAND3 HUTI_composite_bact AAA_29 RsgA_GTPase AAA_25 AAA_18 SLFN-g3_helicase AAA_30 AAA_15 Cytidylate_kin ABC_membrane_2 NB-ARC MMR_HSR1 AAA_24 Activator-TraM
Other DBs
NCBI-ProteinID: AGB78850
LinkDB
Position
complement(2962588..2964336)
AA seq 582 aa
MQNDKDLSTWQTFRRLWPTIAPFKAGLIVAAVALIFNAASDTFMLSLLKPLLDDGFGKTD
RSVLLWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTVRRRLFSHMMGMPVSFFDKQS
TGTLLSRITYDSEQVASSSSSALITVVREGASIIGLFIMMFYYSWQLSLILIVLAPIVSI
AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQQVETKRFDKVSNKMRLQ
GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMETLTAGTITVVFSSMIALMRPLKS
LTNVNAQFQRGMAACQTLFAILDSEQEKDEGTRVVERAKGDLEFRNVTFTYPGRETPALR
DINLSIPEGKTVALVGRSGSGKSTIASLITRFYDIDKGEILLDGHDLREYTLASLRNQVA
LVSQNVHLFNDTVANNIAYARTEEFSREQIEKAAEMAYAMDFINKMDQGLDTVIGENGVL
LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS
TIEQADEIVVVEDGRIVERGSHTDLLAHRGVYAQLHKMQFGE
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgcagaacgacaaagatctctccacgtggcagaccttccgccgactctggccgactatt
gcgccatttaaagcagggctgattgtggctgcggttgcgttaatcttcaacgcagccagc
gatacctttatgctatcgctcctcaaaccattactggatgatggttttggtaaaacggac
aggtcagtgctgttatggatgccattggtggtaattggtctgatgatcctcaggggcatc
accagttatatctccagttattgcatctcctgggtttccggcaaggtcgttatgaccgtg
cgccgccgcttattcagtcacatgatggggatgcccgtctccttcttcgataagcaatct
accggtacgctgctttctcgtattacatacgactccgagcaggtggcatcgtcttcttcc
agcgcgctgattaccgtcgtgcgtgaaggcgcatcgatcatcggtctgttcatcatgatg
ttctactacagctggcagctgtcgctgatcctcatcgtgctggcgccgattgtgtcgatt
gctatccgtgtggtttctaagcgcttccgtaacatcagtaaaaatatgcaaaacacgatg
gggcaggtgaccaccagtgcagagcagatgctgaaagggcacaaagaggtgctgattttc
ggtggtcagcaggttgagaccaaacgcttcgataaagtcagcaataagatgcgtctgcag
ggcatgaaaatggtttctgcgtcttctatctctgacccgatcattcagctgattgcttct
ctggcgctggcctttgtcctgtatgccgcaagtttcccaagcgtcatggaaaccctgact
gccggtactatcaccgtggtcttctcatccatgattgccctgatgcgcccgctgaaatcg
ctgactaacgtcaacgcgcagttccagcgcgggatggctgcctgccagacgctgtttgct
atcctcgatagcgagcaggaaaaagacgaaggtacccgcgtggttgaacgtgcgaaaggc
gaccttgagttccgtaatgtcacctttacctatcctggccgtgaaacgcctgcgctgcgc
gatatcaacctgtcgattccggaaggcaaaacggtggcgctggtagggcgttcgggctca
ggtaaatcaaccattgcgagcctgatcacccgcttctacgatatcgacaagggcgaaatt
ctgctcgacgggcatgacctgcgtgagtacaccctggcgtcactgcgtaatcaggttgcg
ctggtatcgcaaaacgttcacctgttcaacgataccgttgccaataacattgcttatgcg
cgtaccgaagagttcagccgtgagcagatcgaaaaagccgcggaaatggcctatgccatg
gactttatcaataagatggatcaggggctggatacggttatcggcgaaaacggcgtgttg
ctctccggcggccagcgtcagcgtattgccattgcccgtgcgctgctgcgcgacagccca
atcctgattcttgacgaagccacctctgcgctggatacggaatcagaacgtgcgatccag
gccgcgttggatgaattacagaagaaccgtacctcactggtgattgcgcaccgtctgtcg
actatcgaacaggcggacgaaattgtggtggtggaagatggtcgtatcgttgaacgcggt
agccatacggatttgctggcccatcgcggcgtatacgcacaactgcacaagatgcaattt
ggcgaatga

DBGET integrated database retrieval system