Erwinia billingiae: EbC_04520 Help Entry EbC_04520         CDS       T01270                                  Symbol hfQ Name (GenBank) Host factor-I protein   KO K03666   host factor-I protein Organism ebi  Erwinia billingiae Pathway ebi02024   Quorum sensing ebi03018   RNA degradation Brite KEGG Orthology (KO) [BR:ebi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     EbC_04520 (hfQ)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     EbC_04520 (hfQ)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ebi03019]     EbC_04520 (hfQ)    03036 Chromosome and associated proteins [BR:ebi03036]     EbC_04520 (hfQ) Messenger RNA biogenesis [BR:ebi03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      EbC_04520 (hfQ) Chromosome and associated proteins [BR:ebi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     EbC_04520 (hfQ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  CAX57983 UniProt:  D8MM99 LinkDB All DBs Position 540494..540802 Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGSSNYHHGSNQGASTQPQQESDDTE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatcattgcaagatccgttcttgaacgcgctgcgtcgtgaacgtgtt ccggtttcgatttatttggtgaatggtatcaaactgcagggtcagatcgagtcgtttgat caatttgtaattctattgaaaaacacagttagccagatggtgtacaagcacgctatctcg actgttgttccgtcccgtccggtctcccaccacagcaacaatgcgggtggcggaagcagc aactatcatcatggcagtaaccagggggcgtctactcagcctcagcaagagagtgacgac acagagtaa

DBGET integrated database retrieval system