Erwinia billingiae: EbC_20480
Help
Entry
EbC_20480 CDS
T01270
Name
(GenBank) probable transcriptional regulator
KO
K05804
AraC family transcriptional regulator, mar-sox-rob regulon activator
Organism
ebi
Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:
ebi00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
ebi03000
]
EbC_20480
03036 Chromosome and associated proteins [BR:
ebi03036
]
EbC_20480
Transcription factors [BR:
ebi03000
]
Prokaryotic type
Helix-turn-helix
AraC family
EbC_20480
Chromosome and associated proteins [BR:
ebi03036
]
Prokaryotic type
Nucleoid associated proteins
Other nucleoid associated proteins
EbC_20480
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HTH_18
HTH_AraC
Motif
Other DBs
NCBI-ProteinID:
CAX59579
UniProt:
D8MRX2
LinkDB
All DBs
Position
2315131..2315472
Genome browser
AA seq
113 aa
AA seq
DB search
MSHDDFITDLVKWIDTHIEGKMDLDTVADRAGYSKWHLQRMFKQHTGYALGEYIRARRLK
KSAERLATGGEPILDVAISFGFDSQQSFNRSFKRQFGQSPGAWRRQVQVSACS
NT seq
342 nt
NT seq
+upstream
nt +downstream
nt
atgagccatgatgattttattaccgatctcgtaaagtggatcgacacccacatcgaaggg
aaaatggatctggataccgttgccgatcgggccgggtattcgaaatggcacctgcaacgg
atgttcaagcagcataccggctacgcactgggcgaatacatccgcgcacgtcgtctgaaa
aaatctgctgagcgcctggcaacgggtggtgagccgattctggatgtggcgatttcgttt
ggatttgattcccagcagtcgttcaaccgcagcttcaaacgtcagtttggtcagtctccg
ggcgcatggcgtcgacaggttcaggtcagcgcctgttcataa
DBGET
integrated database retrieval system