KEGG   Erwinia billingiae: EbC_20480
Entry
EbC_20480         CDS       T01270                                 
Name
(GenBank) probable transcriptional regulator
  KO
K05804  AraC family transcriptional regulator, mar-sox-rob regulon activator
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ebi03000]
    EbC_20480
   03036 Chromosome and associated proteins [BR:ebi03036]
    EbC_20480
Transcription factors [BR:ebi03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    EbC_20480
Chromosome and associated proteins [BR:ebi03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucleoid associated proteins
    EbC_20480
SSDB
Motif
Pfam: HTH_18 HTH_AraC
Other DBs
NCBI-ProteinID: CAX59579
UniProt: D8MRX2
LinkDB
Position
2315131..2315472
AA seq 113 aa
MSHDDFITDLVKWIDTHIEGKMDLDTVADRAGYSKWHLQRMFKQHTGYALGEYIRARRLK
KSAERLATGGEPILDVAISFGFDSQQSFNRSFKRQFGQSPGAWRRQVQVSACS
NT seq 342 nt   +upstreamnt  +downstreamnt
atgagccatgatgattttattaccgatctcgtaaagtggatcgacacccacatcgaaggg
aaaatggatctggataccgttgccgatcgggccgggtattcgaaatggcacctgcaacgg
atgttcaagcagcataccggctacgcactgggcgaatacatccgcgcacgtcgtctgaaa
aaatctgctgagcgcctggcaacgggtggtgagccgattctggatgtggcgatttcgttt
ggatttgattcccagcagtcgttcaaccgcagcttcaaacgtcagtttggtcagtctccg
ggcgcatggcgtcgacaggttcaggtcagcgcctgttcataa

DBGET integrated database retrieval system