Erythrobacteraceae bacterium WH01K: PF049_06865 Help Entry PF049_06865       CDS       T10954                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ebk  Erythrobacteraceae bacterium WH01K Brite KEGG Orthology (KO) [BR:ebk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ebk03032]     PF049_06865    03036 Chromosome and associated proteins [BR:ebk03036]     PF049_06865    03400 DNA repair and recombination proteins [BR:ebk03400]     PF049_06865 DNA replication proteins [BR:ebk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PF049_06865 Chromosome and associated proteins [BR:ebk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PF049_06865 DNA repair and recombination proteins [BR:ebk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PF049_06865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 Motif Other DBs NCBI-ProteinID:  WBY15347 LinkDB All DBs Position 1382734..1383006 Genome browser AA seq 90 aa AA seqDB search MNKNELIGAVADASGLSKNDAASAVEGVFDAITKTLSKGDEVRLVGFGTFSVARRKASTG RNPRTGEPMTIKASNQPKFKAGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagaacgaacttatcggtgcggttgccgacgccagcggcctttccaagaacgac gcagccagcgccgtggaaggtgtcttcgatgcgatcaccaagacgctttcgaagggcgac gaagttcgtctggtgggcttcggcacgttctccgtcgcccgccgcaaggcttcgacgggc cgtaacccgcgcaccggcgagccgatgacgatcaaggcatcgaaccagccgaagttcaag gctggcaagggcctgaaggacgccgtcaactaa

DBGET integrated database retrieval system