KEGG   Escherichia coli BL21(DE3): ECD_03977
Entry
ECD_03977         CDS       T00931                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATPase
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECD_03977 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebl02000]
    ECD_03977 (phnC)
Enzymes [BR:ebl01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     ECD_03977 (phnC)
Transporters [BR:ebl02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    ECD_03977 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_16 RsgA_GTPase SMC_N AAA_23 NACHT AAA_25 AAA_5 nSTAND1 AAA_18 Mg_chelatase ORC-CDC6-like AAA_22 AAA_30 PRK MMR_HSR1 AAA_28 nSTAND3 T2SSE PhoH AAA_33 Rad17 AAA_24 SbcC_Walker_B bpMoxR AAA_7 AAA_19 cobW TsaE AAA_14
Other DBs
NCBI-ProteinID: ACT45767
LinkDB
Position
complement(4231556..4232344)
AA seq 262 aa
MQTIIRVEKLAKTFNQHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITGDKSA
GSHIELLGRTVQREGRLARDIRKSRANTGYIFQQFNLVNRLSVLENVLIGALGSTPFWRT
CFSWFTREQKQRALQALTRVGMVHFAHQRVSTLSGGQQQRVAIARALMQQAKVILADEPI
ASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCERIVALRQGHVFYDGSSQQF
DNERFDHLYRSINRIEENAKAA
NT seq 789 nt   +upstreamnt  +downstreamnt
atgcaaacgattatccgtgtcgagaagctcgccaaaaccttcaatcagcatcaggcgctg
catgcggttgatctgaacattcatcacggtgaaatggtggctctgcttgggccgtcgggt
tccggcaaatccacccttttacgtcacttaagcggtttgattaccggcgataaatccgcc
ggcagccatatcgagctgctgggccgcacagtccagcgcgaaggccgtctggcgcgcgat
atccgcaaaagccgcgccaacaccggctacatcttccaacaattcaacctggtgaaccgc
ctgagcgtactggagaacgtgctgattggcgcgctcggcagcacgccgttctggcgcacc
tgttttagctggtttacccgcgagcagaaacaacgcgcgttacaggcgctgacccgcgtt
ggcatggtgcattttgcccatcaacgcgtttccaccctctccggcggacagcagcagcgt
gtggcgattgcccgcgcgctgatgcagcaggcgaaggtgattctggccgatgaacccatc
gcctcgctggacccggaatccgcccgcatcgtgatggacaccctgcgcgacatcaatcag
aacgacggcatcaccgtggtcgtcacgctgcatcaggtggattacgccctgcgctactgc
gaacgcatcgtcgccctgcgccaggggcacgttttctacgacggcagcagccaacagttt
gataacgaacgttttgaccatctctaccgcagcattaatcgcatcgaagagaacgcgaaa
gctgcctga

DBGET integrated database retrieval system