Entomobacter blattae: JGUZn3_13040 Help Entry JGUZn3_13040      CDS       T07040                                  Symbol groS1 Name (GenBank) 10 kDa chaperonin 1   KO K04078   chaperonin GroES Organism ebla  Entomobacter blattae Brite KEGG Orthology (KO) [BR:ebla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ebla03110]     JGUZn3_13040 (groS1)    03029 Mitochondrial biogenesis [BR:ebla03029]     JGUZn3_13040 (groS1) Chaperones and folding catalysts [BR:ebla03110]  Heat shock proteins   HSP10    JGUZn3_13040 (groS1) Mitochondrial biogenesis [BR:ebla03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     JGUZn3_13040 (groS1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  QNT78530 UniProt:  A0A7H1NRX0 LinkDB All DBs Position 1493197..1493487 Genome browser AA seq 96 aa AA seqDB search MTKFRPLHDRVLVRRLDSEEKTAGGIIIPDTAKEKPMEGKVIAVGSGARSEEGKVTPLDV KAGDTVLFGKWSGTEVKINGEDLLIMKESDILGIIG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacgaagtttcgtcctttgcatgatcgagtactggttcgtcgcctcgatagtgaagaa aagacagctggtggcattattattccagatacagcaaaagaaaagcctatggaaggtaaa gtgattgctgtaggttccggtgctcggagcgaagaaggaaaagtcaccccgttggatgtt aaagcgggcgataccgtgctgtttggcaaatggtctggcacagaagtgaaaattaacggt gaagacctgctgatcatgaaagaaagcgacattctgggaattattggctaa

DBGET integrated database retrieval system