Escherichia coli B REL606: ECB_01090 Help Entry ECB_01090         CDS       T00944                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ebr  Escherichia coli B REL606 Pathway ebr01100   Metabolic pathways ebr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECB_01090 (acpP)    00074 Mycolic acid biosynthesis     ECB_01090 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECB_01090 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ACT38772 LinkDB All DBs Position 1166184..1166420 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system