KEGG   Escherichia coli B REL606: ECB_02172
Entry
ECB_02172         CDS       T00944                                 
Symbol
yfaV
Name
(GenBank) predicted transporter
  KO
K26580  MFS transporter, ACS family, inner membrane transport protein
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebr02000]
    ECB_02172 (yfaV)
Transporters [BR:ebr02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    ECB_02172 (yfaV)
SSDB
Motif
Pfam: MFS_1 Imm21 O-antigen_lig
Other DBs
NCBI-ProteinID: ACT39829
LinkDB
Position
complement(2305376..2306665)
AA seq 429 aa
MSTALLDAVVKKNRVRLIPFMLALYVLAFLDRSNIGFAKQTYQIDTGLSNEAYALGAGIF
FVVYAFLGVPANLLMRKLGARTWIGTTTLLWGFLSAAMAWADTEAKFLIVHTLLGAAEAG
FFPGMIYLTSQWFPQRNRASIMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFV
IEGLLAVGAGVFTFFWLDDTPEQARFLSKQEKTLLINQLASEEQQKVTSRLSDALRNGRV
WQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVTAIPWVAALFGTWLIPRYSD
KTGERRNVAALTLLAAGIGIGLSGLLSPVMAIVALCVAAIGFIAVQPVFWTMPTQLLSGT
ALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLLTLAAVAVIGSLIIFTLRVNRT
VAQTDVAHH
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgagcaccgctttgcttgacgccgtggtgaagaaaaaccgtgtgcgtttaattccgttt
atgttggcgctgtatgtgctggcgtttctcgaccgttcgaatatcggttttgccaaacag
acctaccagattgataccgggttgagtaatgaagcttatgcgctgggagcaggcattttc
tttgtggtatatgcgtttctgggtgttccggcgaatcttttgatgcgcaaactgggggcc
agaacctggattggtacgacaacactgctgtggggatttctttcggcagccatggcatgg
gccgatactgaagcgaaatttctgatagttcacactctgcttggtgctgcggaggccgga
tttttccctggtatgatttatctcacctcgcaatggtttccgcagcgtaatcgcgccagc
attatggggctgttctatatgggcgcaccgctggcgttaacactgggatcaccgctttcc
ggcgcgctgttggagatgcatggatttatggggcatcccggctggttctggatgtttgtg
attgaaggattgttggcagtcggtgctggggtattcacattcttttggcttgatgacaca
ccggagcaggcacgttttctgagtaaacaagaaaaaacgttgcttatcaatcaactggca
agtgaagaacaacagaaagtgacttctcggctgagcgatgcgctgcgtaatggccgagtc
tggcaactagcgattatctacctgaccattcaggtggcggtttacggattaattttcttc
ctgccgacccaggttgcggcattgctgggaacaaaagtgggctttacagcgtcggtggtc
accgccattccgtgggttgcggccttgtttgggacctggcttattccgcgctattccgat
aaaaccggcgaacggcgtaatgtcgcagcgctgacattactggcggcgggcattggtatt
ggtctgtccgggctgctttctccagtaatggcgatcgtagcgctgtgtgttgcagctatc
gggtttattgccgtgcagccagtgttctggacgatgccgacacaactgctttccggtacg
gcgctggctgcgggaattggttttgtaaacctgtttggtgcagtgggcgggtttattgcc
ccgatcctgcgcgtgaaagcagaaacgttatttgccagcgatgcggcgggattactgacg
ctggcagcggtggcggtcatcggttcgctgattattttcactctgcgtgtaaatcgcact
gttgcgcagaccgacgtggcacatcattaa

DBGET integrated database retrieval system