Escherichia coli B REL606: ECB_02853 Help Entry ECB_02853         CDS       T00944                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism ebr  Escherichia coli B REL606 Pathway ebr01100   Metabolic pathways ebr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECB_02853    00074 Mycolic acid biosynthesis     ECB_02853   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECB_02853 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  ACT40503 LinkDB All DBs Position 3060118..3060366 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system