Ectothiorhodospira sp. BSL-9: ECTOBSL9_0415 Help Entry ECTOBSL9_0415     CDS       T04374                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism ebs  Ectothiorhodospira sp. BSL-9 Brite KEGG Orthology (KO) [BR:ebs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ebs03036]     ECTOBSL9_0415 Chromosome and associated proteins [BR:ebs03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     ECTOBSL9_0415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL Motif Other DBs NCBI-ProteinID:  ANB03606 UniProt:  A0A167BKL3 LinkDB All DBs Position complement(405704..405928) Genome browser AA seq 74 aa AA seqDB search MASALAVIHSKHQSRLLFMELQREVNLRDELNIEWGQLQLEQSTWATHGRIEDAASQRLD MRLPGSRTTVILLE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggccagtgccctggccgtgatccacagcaagcaccagagccgcctgctgttcatggaa ctgcaaagggaagtgaacctgagggacgaactgaatatcgagtgggggcagttgcagttg gagcagagtacctgggccacccatggccggatcgaggacgcggcgagtcagcggctggac atgcgtctgcccggtagccgcaccaccgtgatcctgctggagtga

DBGET integrated database retrieval system