Ectothiorhodospira sp. BSL-9: ECTOBSL9_1542 Help Entry ECTOBSL9_1542     CDS       T04374                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ebs  Ectothiorhodospira sp. BSL-9 Pathway ebs01100   Metabolic pathways ebs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECTOBSL9_1542    00074 Mycolic acid biosynthesis     ECTOBSL9_1542   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECTOBSL9_1542 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ANB03761 UniProt:  A0A167BPR2 LinkDB All DBs Position 1642674..1642922 Genome browser AA seq 82 aa AA seqDB search MSTEAAIKKILDSVLNLGGRAEGFDRSTPLLGSVPELDSMAVVNLLTSLEEQFGIIVDDD EVSAETFETLGSLADFVEAKSN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcaacggaagcagccatcaaaaagatcctggactcggttctcaacctgggggggcga gccgagggtttcgatcgatcaacgccactgcttggcagcgtgcctgaactggactccatg gcggtggtgaatctgctcacgtccctggaagaacaattcggcatcatcgttgacgatgat gaggtgagtgcggaaaccttcgagaccctagggagcctggccgatttcgtcgaggccaag agcaactga

DBGET integrated database retrieval system