Ectothiorhodospira sp. BSL-9: ECTOBSL9_2691 Help Entry ECTOBSL9_2691     CDS       T04374                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ebs  Ectothiorhodospira sp. BSL-9 Pathway ebs01100   Metabolic pathways ebs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECTOBSL9_2691    00074 Mycolic acid biosynthesis     ECTOBSL9_2691   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECTOBSL9_2691 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 HLH DUF1896 Motif Other DBs NCBI-ProteinID:  ANB03118 UniProt:  A0A167B6W7 LinkDB All DBs Position complement(2885967..2886209) Genome browser AA seq 80 aa AA seqDB search MSNIEERVKKIVVEQLGVKEEDVTNSASFVDDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQQAIDYINEHLPSA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcaatatcgaagaacgcgtcaagaaaatcgtcgttgagcaactcggcgttaaagag gaagacgtcaccaacagtgcctctttcgtggacgatctcggcgcggattcactggacacc gttgaactggtgatggcgctggaagaggaattcgaaaccgaaattcctgacgagcaggcc gagaagatcaccaccgttcagcaggccatcgactacatcaatgagcacctgccgagcgcc tga

DBGET integrated database retrieval system