Shimwellia blattae: EBL_c15520
Help
Entry
EBL_c15520 CDS
T02111
Symbol
uvrY
Name
(GenBank) response regulator UvrY
KO
K07689
two-component system, NarL family, invasion response regulator UvrY
Organism
ebt
Shimwellia blattae
Pathway
ebt02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
ebt00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
EBL_c15520 (uvrY)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
ebt02022
]
EBL_c15520 (uvrY)
Two-component system [BR:
ebt02022
]
NarL family
BarA-UvrY (central carbon metabolism)
EBL_c15520 (uvrY)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
GerE
Sigma70_r4_2
HTH_29
HTH_23
HTH_24
HTH_Mga
Sigma70_r4
HTH_5
HTH_7
HTH_26
HTH_28
HTH_11
Terminase_5
HTH_Tnp_ISL3
T6SS_FHA_C
Motif
Other DBs
NCBI-ProteinID:
AFJ46649
UniProt:
I2B7Z5
LinkDB
All DBs
Position
1616482..1617138
Genome browser
AA seq
218 aa
AA seq
DB search
MINVLLVDDHELVRAGIRRILEDIKGIKVAGEACCGEDAVKWCRTNPVDVVLMDMSMPGI
GGLEATRKIARASSDIRVIMLTVHTENPLPTRVMQAGAAGYLSKGAAPQEVVSAIRSVHS
GQRYIASDIAQQMALSQIEPAKTESPFASLSERELQIMLMITRGQKVNEISEQLNLSPKT
VNSYRYRMFSKLNISGDVELTHLAIRHGLCSAETLASQ
NT seq
657 nt
NT seq
+upstream
nt +downstream
nt
ttgatcaacgtacttcttgttgatgatcacgaactggtgcgcgcagggatacgacgcatt
cttgaagatatcaagggcataaaagtcgccggggaggcctgctgcggcgaagatgccgta
aaatggtgcaggaccaatccggttgatgttgtgttgatggacatgagcatgcccggtatt
ggtggcctggaagcaacacgtaagattgcccgcgcatcgtctgatattcgggtgattatg
ctgaccgtccatactgaaaacccattacccaccagggtgatgcaggccggggcagcaggt
tacctgagtaaaggcgccgccccccaggaggtggtcagcgctatccgttcggtgcactcc
gggcagcgttatatcgcttctgatatcgcccagcaaatggcgctgagccagattgaaccc
gcaaagacagaatcgccttttgccagtttgtctgaacgcgaattacagattatgctgatg
atcacccggggccagaaggtcaacgagatctcagaacagctgaatctcagcccgaaaacg
gtgaacagctatcgctaccggatgttcagtaagctgaatatcagtggggatgttgagttg
acccacctggctatccgtcatggtctctgcagtgcggagacattagccagtcagtga
DBGET
integrated database retrieval system