Shimwellia blattae: EBL_c24300 Help Entry EBL_c24300        CDS       T02111                                  Symbol dinI Name (GenBank) DNA-damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ebt  Shimwellia blattae Brite KEGG Orthology (KO) [BR:ebt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ebt03400]     EBL_c24300 (dinI) DNA repair and recombination proteins [BR:ebt03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     EBL_c24300 (dinI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI NFACT-R_2 DUF5374 Motif Other DBs NCBI-ProteinID:  AFJ47519 UniProt:  I2BAG5 LinkDB All DBs Position 2486911..2487156 Genome browser AA seq 81 aa AA seqDB search MRVEVTIARTTVLPPGAVDALSLELAARINHHYADSENHVQVRYASGNNLSVIGAAKEDK DRISEILQETWESADDWFSPA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtgtagaggtcactattgccagaacgacggtgctccccccgggcgccgttgatgcg ctcagcctggagctggccgcgcgtatcaaccatcactacgctgacagcgaaaaccatgtg caggtgcgttacgccagcggtaacaacctgtcggttatcggtgccgctaaagaagacaaa gaccgcatcagcgagatcctccaggaaacctgggaaagcgccgatgactggttcagcccg gcataa

DBGET integrated database retrieval system