Shimwellia blattae: EBL_c39070
Help
Entry
EBL_c39070 CDS
T02111
Symbol
kdtB
Name
(GenBank) phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
ebt
Shimwellia blattae
Pathway
ebt00770
Pantothenate and CoA biosynthesis
ebt01100
Metabolic pathways
ebt01240
Biosynthesis of cofactors
Module
ebt_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
ebt00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
EBL_c39070 (kdtB)
Enzymes [BR:
ebt01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
EBL_c39070 (kdtB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
AFJ48935
UniProt:
I2BEI1
LinkDB
All DBs
Position
4045803..4046291
Genome browser
AA seq
162 aa
AA seq
DB search
MSTRAIYPGTFDPITNGHIDIIRRAAAMFDQVILAIAASPGKKPLFTLEERVALARDALA
HIPNVDVLGFSDLMANFAREQQANILVRGLRGVADFEYEMQLAQMNSHLMPGLESVFLMP
AKEWSFVSSSLVKEVARHHGDVAHFLPGQVCQALLAKIRTGQ
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgtcaaccagggctatctatccgggcacgtttgaccccatcaccaacggtcatattgat
attatccgccgcgccgccgccatgttcgatcaggtcatcctggcgattgcggcaagcccg
ggcaaaaaaccgctatttacgctggaagagcgcgtagcgctggcccgcgatgccctggcg
catattccgaatgtggacgtgctgggtttcagtgatttaatggctaacttcgcccgggag
cagcaggccaacattctggtgcgcggcctgcggggcgtggcggattttgaatacgaaatg
cagctggcgcaaatgaacagccacctgatgccggggctggaaagtgtgttcctgatgccc
gcgaaggagtggtcgttcgtctcgtcttcgctggtaaaagaggtggcccgccaccatggc
gatgtggcccacttcctgcccgggcaggtgtgccaggcgttactggcaaaaatccgcacc
ggccagtaa
DBGET
integrated database retrieval system