Shimwellia blattae: EBL_c39880 Help Entry EBL_c39880        CDS       T02111                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism ebt  Shimwellia blattae Pathway ebt01100   Metabolic pathways ebt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EBL_c39880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EBL_c39880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFJ49012 UniProt:  I2BEQ8 LinkDB All DBs Position 4130581..4130841 Genome browser AA seq 86 aa AA seqDB search MLNREMVMDYILECLQGMVANGQEIKPDSDLVDELGLESIKVMDLLMMLEDQYDISIPIN ILLDVRTPAQLLDALVPHLEKTYGPL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctaaatcgtgaaatggtgatggattatatccttgagtgtctacagggtatggttgca aacggacaggagattaagcctgacagcgatctcgttgatgagcttggtctggagtctatc aaagtgatggacctgctgatgatgctggaagaccagtatgatatctctatcccaatcaat atcttgcttgatgtcagaacacctgcgcaattgctggacgctttagtcccacatctggag aaaacctatgggcctttatga

DBGET integrated database retrieval system