KEGG   Enterobacteriaceae bacterium S05: CUC76_10150
Entry
CUC76_10150       CDS       T05725                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CUC76_10150 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebu02000]
    CUC76_10150 (phnC)
Enzymes [BR:ebu01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     CUC76_10150 (phnC)
Transporters [BR:ebu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    CUC76_10150 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 KdpD MMR_HSR1 AAA_30 AAA_16 Cellulase AAA_22 MeaB DO-GTPase2 AAA_23
Other DBs
NCBI-ProteinID: AWB61935
LinkDB
Position
2032732..2033574
AA seq 280 aa
MNSSLAAVAETDFQPFTELNAGRQRKVLSVRNLSKAYQAQHKVLDGISFDLHAGEMVGII
GRSGAGKSTLLHVLNGTHSASGGEILSYPEVGTPHDVSQLKGRALNAWRSHCGMIFQDFC
LVPRLDVLTNVLLGRLSQTSTLKSLFKIFPEADRARAIALLEWMNMLPHALQRAENLSGG
QMQRVAICRALMQNPGILLADEPVASLDPKNTQRIMDVLREISEQGISVMVNLHSVELVK
TYCTRVIGVASGQLIFDDHPSRLTQDVLQRLYGDEVSQLH
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaacagctctcttgccgcggtggccgaaactgatttccagccgttcaccgaactcaat
gccggccggcagcggaaggtcttaagcgtgcgtaatctgagtaaagcttatcaagcccag
cacaaggtgctggacggcatcagctttgatctgcacgctggcgaaatggttggcatcata
ggccgctccggcgccggtaaatcgacgctcctgcatgtcctcaacggcacccacagcgcc
agcggcggagaaattcttagctacccggaagtcggtaccccgcacgatgtctcacagctg
aaaggtcgcgcgctcaatgcctggcgcagccactgcggaatgatttttcaggacttctgc
ctggtgccccgtctcgatgtgctcaccaacgtcctgctgggccgcctcagccagacttca
accctgaaatcgctgtttaaaatctttcctgaagctgaccgggcgcgcgccattgcgctg
cttgagtggatgaacatgctgccgcacgcgctgcagcgggcggagaacctctccggcggg
cagatgcagcgggtggcgatctgccgggcgctgatgcaaaaccccggcatcctgctggcc
gacgagcctgtcgcctcgctggatccgaaaaacacacagcgcatcatggatgtgttgcgc
gaaattagcgagcagggcatcagcgtaatggtaaacctgcattcggtagagctggtgaag
acctactgcacccgggttatcggcgtcgccagcggccagcttatttttgacgatcacccc
tcccggctgacgcaggatgtgctgcagcggctgtacggcgatgaagttagccaattgcat
taa

DBGET integrated database retrieval system