Enterobacteriaceae bacterium S05: CUC76_16350 Help Entry CUC76_16350       CDS       T05725                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ebu  Enterobacteriaceae bacterium S05 Brite KEGG Orthology (KO) [BR:ebu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ebu03110]     CUC76_16350 Chaperones and folding catalysts [BR:ebu03110]  Protein folding catalysts   Protein disulfide isomerase    CUC76_16350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR CLIC-like_N GST_N Motif Other DBs NCBI-ProteinID:  AWB63033 LinkDB All DBs Position 3280083..3280334 Genome browser AA seq 83 aa AA seqDB search MANIEIYTKATCPFCIRAKALLNSKGVTFHELPIDGDAAKREEMIQRSGRTTVPQIFIDA QHIGGCDDLYALDSRGGLDPLLR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatattgagatctacaccaaagcgacctgcccgttctgcatccgcgcgaaagcg ctgctgaacagcaaaggcgtaacgttccatgagttgccgatcgatggcgatgccgcgaag cgtgaggagatgatccagcgcagcggacggacgacggttccgcagatttttattgatgcg cagcacattggcggctgtgacgacttgtatgcgcttgattcacgtggtggacttgatccc ctcttgcgctaa

DBGET integrated database retrieval system