Enterobacteriaceae bacterium S05: CUC76_17045 Help Entry CUC76_17045       CDS       T05725                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ebu  Enterobacteriaceae bacterium S05 Pathway ebu01100   Metabolic pathways ebu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CUC76_17045    00074 Mycolic acid biosynthesis     CUC76_17045   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CUC76_17045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AWB63160 LinkDB All DBs Position complement(3435514..3435771) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIISTLNLDELSADDIDTDAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFYSVATLAAFIQAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaaaaatctgatcatcagtaccttgaacctggacgag ctgtccgctgatgatatcgacaccgatgccgcgctttttggcgatggtctgggcctggac tcaattgatgcgctggagctgggtctggcggtaaaaaatcagtacggcgtggtgctgtcg gctgaaagtgaagagatgcgtcagcatttctactctgtcgccacgctggcggcatttatt caagcacagcgcgcctga

DBGET integrated database retrieval system