KEGG   Enterobacteriaceae bacterium S05: CUC76_21045
Entry
CUC76_21045       CDS       T05725                                 
Name
(GenBank) 3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu00260  Glycine, serine and threonine metabolism
ebu00270  Cysteine and methionine metabolism
ebu00680  Methane metabolism
ebu01100  Metabolic pathways
ebu01110  Biosynthesis of secondary metabolites
ebu01120  Microbial metabolism in diverse environments
ebu01200  Carbon metabolism
ebu01230  Biosynthesis of amino acids
Module
ebu_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CUC76_21045
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CUC76_21045
   00270 Cysteine and methionine metabolism
    CUC76_21045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebu04147]
    CUC76_21045
Enzymes [BR:ebu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     CUC76_21045
    1.1.1.399  2-oxoglutarate reductase
     CUC76_21045
Exosome [BR:ebu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CUC76_21045
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 NAD_binding_7 3HCDH_N XdhC_C DRTGG
Other DBs
NCBI-ProteinID: AWB63895
LinkDB
Position
4212711..4213658
AA seq 315 aa
MSAKNVILITGSDLADAALGMLEDYELVFAGRQPTEAQLIALCQQHNPVAILVRYGHITA
AVMDAAPALKVIAKHGSGIDVIDVEAAAARGILVRAATGANAAAVSEHTWALILACAKSV
IPLDRRLREGHWDKSTHKSLELEGRTLGLIGLGAIGSRVAKIACAFGMKVLAYDPYAKAV
PPECERVAELSELLMQADVLSLHCPLTQQNRGMINAATLAQCKPGAILVNTARGGLIDDA
ALAAALKAGTLRWAALDSFNSEPLTTPHIWQAIDNVILSPHVGGVSDASYVKMGTAAAAN
ILQVLQELAQTETTY
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagcgctaaaaatgtcatactgattaccggcagcgatttggctgacgcggcgctgggg
atgctggaagattacgaacttgtctttgccggccgccagcctacagaggcccagctgatc
gcgctgtgccagcagcacaatcccgtcgccatcctggtgcgctatggccacatcactgcc
gccgttatggatgccgcccctgcattgaaggtgattgccaaacatggcagtggcatcgat
gtcattgacgttgaggcggctgccgcgcgcggcattctggttcgcgcggcgaccggggcg
aatgccgccgcggtttccgaacacacctgggcgttaattctggcctgtgctaagtcggtc
attccgcttgatcgccgcctgcgcgaagggcactgggataaatcaacgcataaatcgctt
gagcttgagggcagaacgctgggactcatcggcctcggcgccattggcagccgggtggcg
aagattgcctgtgcctttggcatgaaggttctggcttacgatccctatgcgaaagcggtt
ccgccggaatgtgaacgtgttgctgaacttagcgagctgctcatgcaggccgatgtgctg
tcgcttcattgccctttgacgcaacaaaacaggggaatgatcaatgccgccacgctggcg
cagtgtaagccgggcgccatcctggtgaataccgcgcgcggcgggttgattgacgatgcg
gcgctggccgcggcattaaaagcggggaccttgcgctgggcggcgcttgacagctttaat
agtgaaccattaaccacgccgcatatctggcaggcgatcgataatgtcattctctctccg
catgtgggcggcgttagcgatgcctcttacgtgaaaatggggaccgccgccgcggccaac
attctgcaggtgctgcaggagttggctcagacagaaacaacgtattaa

DBGET integrated database retrieval system