Enterobacteriaceae bacterium S05: CUC76_22695 Help Entry CUC76_22695       CDS       T05725                                  Name (GenBank) hypothetical protein   KO K03503   DNA polymerase V [EC:3.4.21.-] Organism ebu  Enterobacteriaceae bacterium S05 Brite KEGG Orthology (KO) [BR:ebu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ebu01002]     CUC76_22695   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ebu03400]     CUC76_22695 Peptidases and inhibitors [BR:ebu01002]  Serine peptidases   Family S24: LexA family    CUC76_22695 DNA repair and recombination proteins [BR:ebu03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Y-family DNA polymerases     CUC76_22695 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DUF4845 Motif Other DBs NCBI-ProteinID:  AWB64180 LinkDB All DBs Position 4538760..4539077 Genome browser AA seq 105 aa AA seqDB search MGFPSPASDYVEQRLSVNSICNVGPNTLVFERSGGYVVLDISLKPKQGSQVLIQHGGGTE LATLRGKLLITEDGEAIEGEALDDVTVIGVVTFTICDVRSDNSII NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggctttccttcgccggcgtcagactacgtcgagcaaaggttgtctgttaactcgatc tgcaatgtcggcccaaacacgctagttttcgagcgatctggtggttacgttgtactggat atctccctgaagccaaagcagggtagtcaggttctgatccagcacggcggcgggacggag cttgccacgctgagaggaaagttactgattaccgaagatggagaagcgatcgagggtgaa gcccttgacgatgtcactgtcatcggcgtcgtgacgttcactatatgcgatgttcgttct gataattctattatttaa

DBGET integrated database retrieval system