Escherichia coli K-12 BW2952: BWG_0942 Help Entry BWG_0942          CDS       T00913                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism ebw  Escherichia coli K-12 BW2952 Pathway ebw01100   Metabolic pathways ebw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BWG_0942 (acpP)    00074 Mycolic acid biosynthesis     BWG_0942 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BWG_0942 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ACR61922 UniProt:  C4ZS34 LinkDB All DBs Position 1054763..1054999 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system