Escherichia coli K-12 BW2952: BWG_3913 Help Entry BWG_3913          CDS       T00913                                  Symbol priB Name (GenBank) primosomal protein N   KO K02686   primosomal replication protein N Organism ebw  Escherichia coli K-12 BW2952 Pathway ebw03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ebw00001]  09120 Genetic Information Processing   09124 Replication and repair    03440 Homologous recombination     BWG_3913 (priB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ebw03400]     BWG_3913 (priB) DNA repair and recombination proteins [BR:ebw03400]  Prokaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     RecBC pathway proteins      BWG_3913 (priB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB_1 SSB tRNA_anti-codon Motif Other DBs NCBI-ProteinID:  ACR65273 UniProt:  C4ZR78 LinkDB All DBs Position 4362278..4362592 Genome browser AA seq 104 aa AA seqDB search MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQ AITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccgtctggtgttgtccggcaccgtgtgcagggctccccttcgaaaggtcagt ccatcaggaattcctcactgccagttcgtgcttgagcatcgttctgtgcaggaggaagcc ggctttcaccggcaggcgtggtgtcaaatgcccgttattgttagcggacacgaaaaccag gccattactcacagtataacggtcggcagtcgcataaccgttcaggggttcatttcatgc cacaaggcaaagaacggactgagcaaaatggttttgcatgccgagcagattgaattgata gattctggagactag

DBGET integrated database retrieval system