Xiamenia xianingshaonis: J7S26_06750 Help Entry J7S26_06750       CDS       T08443                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ebz  Xiamenia xianingshaonis Pathway ebz01100   Metabolic pathways ebz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J7S26_06750    00074 Mycolic acid biosynthesis     J7S26_06750   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J7S26_06750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QTU84054 UniProt:  A0A9E6SU44 LinkDB All DBs Position 1794747..1794965 Genome browser AA seq 72 aa AA seqDB search MATIDTIKTVLEENLDIAPETVNEASTFDSLGIDSLDMVELICDLEEACDVDFGEPEGLE TVGDLVEYIESL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggcgaccatcgacacaattaaaactgtgctggaagagaacctggacattgcgccggaa accgtgaacgaagcatcgacgttcgattcgctgggcatcgattcgcttgacatggtcgag ctgatctgcgacctggaagaagcctgcgacgtggacttcggcgaaccggaaggactggaa acggtcggagacctggtggagtacatcgagtcgctgtag

DBGET integrated database retrieval system