Pectobacterium atrosepticum SCRI1043: ECA4265 Help Entry ECA4265           CDS       T00186                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism eca  Pectobacterium atrosepticum SCRI1043 Brite KEGG Orthology (KO) [BR:eca00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eca03036]     ECA4265 Chromosome and associated proteins [BR:eca03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     ECA4265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB CtIP_N Leu_zip Seryl_tRNA_N PspA_IM30 CC149 DUF3450 ERM_helical XRCC4_CC CC2-LZ Nuf2_DHR10-like UPF0242 Herpes_UL6 YabA dCache_2 DUF2968 FlaC_arch APG6_N SlyX Motif Other DBs NCBI-ProteinID:  CAG77162 UniProt:  Q6CZ88 LinkDB All DBs Position complement(4779555..4779794) Genome browser AA seq 79 aa AA seqDB search MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNNTLSQDVQAAAGSRESLVRENEQLKE EQVVWQERLRALLGKMEEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtgtttgaaaagctggaagcgaaagttcagcaagcgattgatactatc acgctattgcaaatggaaattgaagagctgaaagagcagaacaacacgttgtcgcaggat gttcaggcggcagcgggttcacgtgaatcgctggtgcgcgagaacgaacagttgaaagaa gagcaagtggtgtggcaagagcgtttgcgcgcgctgttaggcaaaatggaagaagtctaa

DBGET integrated database retrieval system