Pectobacterium atrosepticum SCRI1043: ECA4504 Help Entry ECA4504           CDS       T00186                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism eca  Pectobacterium atrosepticum SCRI1043 Pathway eca00998   Biosynthesis of various antibiotics eca01100   Metabolic pathways eca01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eca00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECA4504    00074 Mycolic acid biosynthesis     ECA4504   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECA4504 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAG77399 UniProt:  Q6CYK3 LinkDB All DBs Position complement(5044405..5044671) Genome browser AA seq 88 aa AA seqDB search MECLFIEIKEMIIDSLNLEDISVDEIETDAPLFGEGLGLDSIDALELGLAVKNRYGVVLS AESEEVRQHFFSVATLATFINTQRAVSA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaatgtctatttattgaaatcaaagagatgattattgattctcttaatcttgaagat atcagtgttgatgaaatagaaacggacgctccgctttttggcgagggtcttggtctggat tctatcgatgcacttgaactgggattagcggttaaaaaccgttacggcgtcgtactttct gctgaaagtgaagaggtgcgccaacacttcttttctgttgccacccttgctacttttatt aacactcagcgcgctgtgagtgcctga

DBGET integrated database retrieval system